PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G23650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 424aa    MW: 44854.6 Da    PI: 8.967
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G23650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.12.8e-19343377135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  OPUNC02G23650.1 343 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 377
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.018337373IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-18337391IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-14340400No hitNo description
Gene3DG3DSA:3.30.50.102.0E-15341375IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.37E-14342384No hitNo description
PfamPF003203.0E-17343377IPR000679Zinc finger, GATA-type
PROSITE patternPS003440343368IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MTHQALISST PSSFSPASHF LHASSSSPSL SSRRSSHAAA MSSFAHHHHH GSLVEKDGRM  60
SALRSSLRPY EAAEEMAAAA AAGAGPVAAW GAVERGAGMM GDGFSVEDLL DLEELCEVDR  120
DGGDQGEAAA PVAAVEKDRS SDSHGSSVVS YEPMPLLPPV MDLPAHDVEE LEWVSRIMDD  180
SLSELPLPQL PAAAALAVCS KPQHRRPHEG AVSPLVPVRT PTICALSTEA LVPVKSRRSK  240
RSRASVWSLS GAPLSDSTSS SSTATTSSCS SSASFSPFLQ YVDFPTLVAS DLLDEQPRSK  300
KSKHGKNGKQ KPKKRGRKPK HQQPPHLAAG GGAALPAPGD RRCSHCGVQK TPQWRAGPEG  360
AKTLCNACGV RYKSGRLLPE YRPACSPTFV SNLHSNSHRK VLEMRRKKET PVIVAAAAPA  420
VASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1094770.0AK109477.1 Oryza sativa Japonica Group cDNA clone:001-200-C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623357.10.0PREDICTED: GATA transcription factor 6
TrEMBLA0A0E0K2Z30.0A0A0E0K2Z3_ORYPU; Uncharacterized protein
STRINGLOC_Os02g43150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-39GATA transcription factor 5